Ebolos hemoraginė karštligė

 

D. Vėlyvytė


Ebolos hemoraginė karštligė (Ebola hemorrhagic fever) – ypač pavojinga užkrečiama ūminė virusinė liga, kuriai būdingos sunkios formos, karščiavimas, hemoraginis sindromas ir didelis letalumas.
Istoriniai faktai. Pirmą kartą liga buvo aprašyta 1976 m., kilus dviem ligos protrūkiams šiaurės Zaire ir pietų Sudane, kai susirgo daugiau nei 600 asmenų ir 70 proc. ligonių mirė. Virusas išskirtas šiaurės vakarų Zaire prie Ebolos upės.
Etiologija. Sukėlėjas – Ebola virusas, turintis viengrandę RNR, priklausantis Filoviridae šeimai. Virionas yra 80 nm skersmens ir 970 nm ilgio, jį dengia glikoproteino apvalkas (4.15.5 pav.). Yra 4 potipiai, kurių pavadinimai atitinka geografiniųvietovių,kur potipiai buvo išskirti, pavadinimus: Zairo (EBO-Z), Sudano (EBO-S), Dramblio Kaulo Kranto (EBO-CI) ir Restono (EBO-R). Visi potipiai, išskyrus Restono, buvo nustatyti Afrikoje ir sukelia pavojingas ligas, žmonėms dažnai besibaigiančias mirtimi. Restono potipis, išplitęs iš Filipinų, sukelia pavojingą ligą, nuo kurios miršta beždžionės, o žmonėms pasireiškia tik lengva subklinikinė infekcija. Virusas žūsta 60 ºC temperatūroje per 30 min., bet kraujyje kambario temperatūroje gali išlikti savaitėmis. Jis priklauso 4 pavojingumo grupei.
Epidemiologija. Infekcijos rezervuaras ir šaltinis – beždžionės. Plitimo būdai neaiškūs. Galima užsikrėsti nuo sergančio žmogaus, dažniausiai kontakto būdu per kraują ir sekretus. Ligonis išskiria į aplinką virusų iki 3 savaičių. Didžiausia rizika užsikrėsti, kai ligonis vemia, viduriuoja, kraujuoja. Galimi hospitalinės infekcijos atvejai, kai medicinos darbuotojai užsikrečia slaugydami ar gydydami ligonius. Virusas išlieka spermoje iki 3 mėnesių po pasveikimo, todėl infekcija gali būti perduodama lytiniu keliu. Endeminių židinių yra Centrinėje ir Vakarų Afrikoje. Europoje – tik įvežtiniai ligos atvejai.
Patogenezė ir patologija. Sukėlėjų patenka pro kvėpavimo takų gleivinę ar odos pažeidimus. Jie greitai išplinta ir sukelia didelę bendrą intoksikaciją ir trombohemoraginį sindromą. Virusas gerai replikuojasi tiek gyvūnų, tiek žmonių įvairių tipų ląstelėse, tarp jų endotelio ląstelėse, makrofaguose, daugelio organų parenchimos ląstelėse. Viruso replikacija susijusi su ląstelės nekroze tiek in vivo, tiek in vitro. Virusinė endotelio ląstelių infekcija selektyviai slopina MHC I klasės molekules ir blokuoja kelių genų indukciją interferonu. Ūmi infekcija susijusi su didele viremija. Ebola viruso Zairo potipio atveju ligos eigą apsunkina ir didelis kiekis cirkuliuojančių uždegimo citokinų. Histologiniu tyrimu nustatoma kepenų nekrozė, intersticinė pneumonija, aptinkama smegenų glijos mazgų ir mažų infarktų. Atliekant patanatominį tyrimą virusų gali būti išskiriama iš serumo, kraujo, šlapimo, tepinėlio iš nosiaryklės, spermos, kepenų ir limfoidinio audinio.
Endeminėse vietovėse atlikti seroepidemiologiniai tyrimai parodė, kad apie 7 proc. endeminių vietovių gyventojų turi antikūnų nuo Ebola viruso, todėl manoma, kad pasitaiko ir simptomais nepasireiškiančių ar lengvos formos infekcijų, kurios lieka nediagnozuotos. Klinika. Inkubacijos periodas trunka 5–10 dienų (gali būti ir nuo 2 iki 19 dienų). Ligos pradžia ūmi, pasireiškia karščiavimu, silpnumu, galvos skausmu, raumenų ir sąnarių skausmais, pykinimu, vėmimu. Vėliau gausiai viduriuojama, vargina krūtinės ir pilvo skausmai, konjunktyvitas. Nuo 5 ligos dienos atsiranda hemoraginio sindromo požymių: petechijų, kraujuoja iš nosies, ligonis vemia ir tuštinasi krauju, nėščioms ligonėms gresia savaiminis abortas ir didelis kraujavimas. Antrosios ligos savaitės pradžioje dažnai būna trumpalaikis, į tymus panašus liemens makulopapulinis bėrimas, po 4–5 dienų pereinantis į pleiskanojimą. Padidėja kepenys, blužnis, atsiranda veido, kaklo edema, vystosi encefalopatija. Sunkiais ligos atvejais netenkama daug kraujo, prasideda inkstų nepakankamumas, ūminis respiracinio distreso sindromas, šokas. Ligoniai miršta 8–16 ligos dieną. Miršta 50 proc. užsikrėtusiųjų Sudano potipiu ir 80–90 proc. užsikrėtusiųjų Zairo potipiu. Simptomais nepasireiškiančios ar lengvos infekcijos formos retos.
Epideminių protrūkių skirtinguose regionuose metu įvairaus sunkumo ligos formų ir mirčių dažnis priklauso nuo biologinių ir antigeninių viruso potipių skirtumų.
Diagnostika. Diagnozė nustatoma pagal būdingus klinikinius ir epidemiologinius duomenis. Kadangi liga ypač pavojinga, visi specifiniaityrimaiatliekamitikspecialiose laboratorijose. Nustatoma kraujo leukopenija, o nuo 4 ligos dienos – neutrofilinė leukocitozė, didelė trombocitopenija, sutrikusi trombocitų agregacija, padidėjęs kepenų fermentų aktyvumas (AST aktyvumas padidėjęs daug daugiau nei ALT). Šlapime daug baltymo. Diagnozė patvirtinama virusų išskyrus iš kraujo ūminėje ligos fazėje, užkrėtus ląstelių kultūras ar jūrų kiaulytes, nustačius virusų elektroniniu mikroskopu, aptikus virusų antigenų kraujyje ELISA būdu ar radus viruso nukleorūgščių kraujyje PGR būdu. Galima virusą atpažinti odos biopsiniuose mėginiuose imunohistocheminiu būdu. Sveikimo periodu galima nustatyti savitųjų IgM klasės antikūnų arba IgG klasės antikūnų titro augimą ELISA ar IFR metodu.
Diferencijuojama nuo kitų hemoraginių karštligių (Marburgo, Lasos, Krymo-Kongo), vidurių šiltinės, maliarijos, tymų, meningokokinės infekcijos.
Gydymas. Etiotropinio gydymo nėra. Patogenezinis ir simptominis gydymas – detoksikuojama į veną lašinant elektrolitų, gliukozės tirpalų, hemoraginio sindromo atvejais skiriama kraujo, trombocitų masės ir plazmos infuzijų, esant inkstų nepakankamumui atliekama peritoninė dializė, ligoniams perpilama persirgusių šia liga žmonių kraujo. Atliktų kelių klinikinių tyrimų duomenimis, bandyti vaistai – α interferonas ir ribavirinas – neefektyvūs gydant šią infekciją.
Priešepideminės priemonės ir profilaktika. Liga priskiriama ypač pavojingų infekcinių ligų grupei.
Virusinės hemoraginės karštligės, tarp jų ir Ebolos hemoraginė karštligė, priklauso privalomai Lietuvoje registruojamų infekcijų grupei. Asmens sveikatos priežiūros specialistai, įtarę Ebolos hemoraginę karštligę, privalo informuoti teritorijos visuomenės sveikatos instituciją skubiu pranešimu. Ligonis hospitalizuojamas, taikomos standartinės ligonių, sergančių per orą plintančiomis infekcijomis, izoliacijos priemonės. Griežtai izoliuojama ūmaus karščiavimo laikotarpiu. Ligonio dažniausiai liečiami paviršiai dezinfekuojami ne rečiau kaip 1 kartą per dieną. Krauju ar kitais kūno skysčiais užteršti aplinkos daiktai ir paviršiai valomi ir dezinfekuojami. Paviršiai dezinfekuojami hipochloritais, chlorkalkėmis, chloraminu, izocianūratais. Atliekos sudedamos į specialų atliekoms sterilizuoti garais tinkamą maišą ir dezinfekuojamos autoklave arba deginamos. Medicinos personalas privalo naudoti asmenines apsaugos priemones: dvigubas vienkartines pirštines, vienkartinį neperšlampamą chalatą ilgomis rankovėmis, vienkartinius arba daugkartinius akinius arba veido skydelį, respiratorių, guminę avalynę arba vienkartinius neperšlampamus avalynės dangalus. Asmenų, su kurias ligonis kontaktavo, būklė stebima 21 d. Sukarščiavęs asmuo hospitalizuojamas ir laikomasi griežtos izoliacijos priemonių.
Specifinės profilaktikosžmonėms nėra.