Marburgo hemoraginė karštligė

D. Vėlyvytė


Marburgo hemoraginė karštligė (Marburg hemorrhagic fever) – ypač pavojinga užkrečiama ūminė virusinė liga, kuriai būdingos sunkios ligos formos, karščiavimas, hemoraginis sindromas, kepenų, virškinamojo trakto ir centrinės nervų sistemos pažeidimai bei didelis letalumas.
Istoriniai faktai. Liga (ir jos sukėlėjas) pirmą kartą buvo nustatyti 1967 m. laboratorijos darbuotojui Marburge (Vokietijoje), užsikrėtusiam nuo žaliosios beždžionės (Cercopithecus aethiops), vakcinos gamybos ir biomedicininių tyrinėjimų tikslu atvežtos iš Ugandos į Europą. Tada susirgo 31 asmuo, 7 iš jų mirė. 2004–2005 m. protrūkio Angoloje metu susirgo 252 asmenys, iš kurių net 90 proc. mirė.
Etiologija. Sukėlėjas – Marburg virusas, turintis viengrandę RNR, priklausantis Filoviridae šeimai. Virionas yra 80 nm skersmens ir 970 nm ilgio, jį dengia glikoproteino apvalkalas (4.15.4 pav.). Sukėlėjo morfologija panaši į tai pačiai šeimai priklausantį Ebola virusą, bet jis turi skirtingus antigenus ir yra mažiau virulentiškas. Virusas buvo nustatytas Afrikoje ir sukelia pavojingą, dažnai mirtiną ligą žmonėms. Jis žūsta 60 ºC temperatūroje per 30 min., bet kraujyje kambario temperatūroje gali išlikti savaitėmis. Virusas priklauso 4 pavojingumo grupei.
Epidemiologija. Infekcijos rezervuaras ir šaltinis – beždžionės. Plitimo būdai neaiškūs. Galima užsikrėsti nuo sergančio žmogaus, dažniausiai sąlyčio būdu, per kraują ir sekretus, oro lašiniu būdu, lytiniu būdu. Virusas išlieka žmogaus organizme iki 3 mėnesių. Endeminių židinių yra Rytų, Centrinėje ir Pietų Afrikoje.
Patogenezė ir patologija. Sukėlėjų patenka pro odos pažeidimus ar gleivines (burnos, akių), jie greitai išplinta ir sukelia didelę bendrą intoksikaciją. Virusai gerai replikuojasi tiek gyvūnų, tiek žmogaus įvairių tipų ląstelėse, tarp jų endotelio ląstelėse, makrofaguose, daugelio organų (kepenų, blužnies, plaučių ir kt.) parenchimos ląstelėse. Viruso replikacija susijusi su ląstelės nekroze tiek in vivo, tiek in vitro. Virusinė endotelio ląstelių infekcija selektyviai inhibuoja MHC I klasės molekules ir blokuoja kelių genų indukciją interferonu. Ūmi infekcija susijusi su didele viremija. Virusų ilgai (iki 12 sav.) išlieka kraujyje, spermoje. Histologiniu tyrimu nustatomas kepenų ląstelių suriebėjimas, nekrozė, infiltracija,aptinkamainkstųkanalėliųepiteliopažeidimų,blužnies, miokardo, plaučių pažeidimų, daugybinių smulkių kraujosruvų įvairiuose organuose, taip pat ir galvos smegenyse. Patologoanatominio tyrimo metu virusų gali būti išskiriama iš serumo, kraujo, šlapimo, tepinėlio iš nosiaryklės, spermos, kepenų ir limfoidinio audinio.
Klinika. Inkubacijos periodas trunka nuo 3 iki 9 dienų. Ligos pradžia ūmi, pasireiškia karščiavimas ir šaltkrėtis, bloga savijauta, galvos skausmas, raumenų ir sąnarių skausmai, duriančio pobūdžio krūtinės skausmas, sustiprėjantis kvėpuojant, kartais sausas kosulys. Juntamas burnos ir gerklės sausumas. Vėliau atsiranda ryklės gleivinės hiperemija, matyti paraudęs liežuvio galiukas ir kraštai. Ant kietojo ir minkštojo gomurio ir liežuvio atsiranda pūslelių, kurioms trūkus susidaro paviršinių erozijų. Padidėja kramtomųjų, kaklo ir nugaros raumenų tonusas, jie skausmingi palpuojant. Nuo trečios–ketvirtos ligos dienos atsiranda stiprus spazminis pilvo skausmas, vandeningas viduriavimas su kraujo priemaiša, kartais melena. Kai kurie ligoniai vemia su tulžies ir kraujo priemaišoms. Beveik pusei ligonių nuo penktos ligos dienos pasireiškia trumpalaikis į tymus panašus liemens makulopapulinis bėrimas, vėliau pereinantis į pleiskanojimą, kartais esant minėtam bėrimui matyti ir pavienių pūslelių. Atsiranda hemoraginio sindromo požymių (kraujosruvų odoje, junginėje, burnos gleivinėje, petechijų, kraujuoja iš nosies, genitalijų, ligonis vemia ir tuštinasi krauju). Pirmos ligos savaitės pabaigoje, rečiau antrosios savaitės pradžioje išryškėja dehidratacijos ir infekcinio toksinio šoko simptomatika, kartais – traukuliai, prarandama sąmonė, padidėja kepenys, blužnis, vystosi inkstų nepakankamumas. Jei ligos forma sunki, 8–16 ligos dieną miršta apie 25 proc. ligonių. Sveikstama 3–4 savaites. Tuomet būdinga alopecija, apetito stoka, pasikartojantis pilvo skausmas, ilgalaikiai psichikos sutrikimai. Vėlyvosioms komplikacijoms priskiriamas mielitas ir uveitas. Aprašyta ligos atkryčių, po pasveikimo praėjus net trims mėnesiams.
Diagnostika. Diagnozė nustatoma pagal būdingus klinikinius ir epidemiologinius duomenis. Kadangi liga ypač pavojinga, visi specifiniaityrimaiatliekamitikspecialiose laboratorijose. Nustatoma kraujo leukopenija, didelė trombocitopenija, sutrikusi trombocitų agregacija, anizocitozė, poikilocitozė, bazofiliniseritrocitųgrūdėtumas,padidėjęs kepenų ir kasos fermentų aktyvumas (amilazė, AST padidėjęs daug daugiau nei ALT). Šlapime daug baltymo, eritrocitų. Diagnozė patvirtinama virusų išskyrus iš kraujo ūminėje ligos fazėje, užkrėtus ląstelių kultūras ar jūrų kiaulytes, nustačius virusų elektroniniu mikroskopu, aptikus virusų antigenų kraujyje ir audiniuose ELISA ar netiesioginės IFR būdu bei radus viruso nukleorūgščių kraujyje PGR būdu. Sveikimo periodu galima nustatyti savitųjų IgM klasės antikūnų arba IgG klasės antikūnų titro augimą ELISA ar IFR (titras didesnis nei 1 : 256) metodu.
Diferencijuojama nuo kitų hemoraginių karštligių (Ebolos, Lasos, Krymo-Kongo), vidurių šiltinės, maliarijos, tymų, meningokokinės infekcijos.
Gydymas. Ligoniai griežtai izoliuojami. Etiotropinio gydymo nėra. Patogenezinis ir simptominis gydymas – detoksikuojama į veną lašinant elektrolitų, gliukozės tirpalų,hemoraginio sindromo atvejais skiriama kraujo, trombocitų masės ir plazmos infuzijų, esant inkstų nepakankamumui atliekama peritoninė dializė. Atliktų kelių klinikinių tyrimų duomenimis, bandyti vaistai – α interferonas, ribavirinas ir persirgusiųjų imuninė kraujo plazma – neefektyvūs gydant šią ligą.
Epideminė priežiūra ir kontrolė. Marburgo hemoraginė karštligė priskiriama karantininėms, ypač pavojingoms infekcijoms. Taikomos tos pačios epidemiologinės priežiūros priemonės, kaip ir sergant Ebolos hemoragine karštlige (žr. „Ebolos hemoraginė karštligė“).