Salmoneliozės (Salmonellosis, nontyphoidal Salmonella infections) yra ūminės žarnyno ligos, sukeliamos daugelio „netifinių“ salmonelių, pasireiškiančios karščiavimu, intoksikacija, gastroenteritu, rečiau – generalizuota forma.
Istoriniai faktai. Epidemiologiškai ir kliniškai panašios ligos buvo žinomos jau seniai ir vadinamos apsinuodijimais maistu, siejant juos su cheminiais toksinais. 1885 m. Salmonas išskyrė B. suipestifer – kiaulių maro sukėlėją, o 1888 m. Gertneris panašių mikrobų aptiko mirusio žmogaus organuose ir jo vartotoje mėsoje. Taip buvo įrodyta šių ligų kilmė ir jų ryšys su gyvulių produktais. Nuo 1934 m. ta mikrobų grupė apjungta į vadinamąją paratifinę rūšį, pavadintą salmonelėmis.
Etiologija. Salmonelės priklauso Enterobacteriaceae šeimai. Tai judrios, gramneigiamos lazdelės, kurios sporų bei kapsulių nesudaro ir negamina egzotoksino. Žūdamos jos išskiria endotoksiną. Bakterija turi termostabilų O antigeną ir termolabilų (žiuželinį) H antigeną. Pagal O antigenus skiriamos salmonelių A, B, C, D, E, F serologinės grupės, o pagal H antigenus – serologiniai tipai (Kauffmann ir White klasifikacija).Įvairiose pasaulio šalyse nustatyta daugiau kaip 2 300 serotipų, o Lietuvoje – daugiau kaip 100. Salmonelės patogeniškos gyvuliams, paukščiams ir žmonėms. Jos gana atsparios, ilgai išsilaiko vandenyje, mėsoje, piene ir kituose maisto produktuose, nežūsta juos džiovinant, sūdant, rūkant. Karštyje žūsta greitai, tačiau stambius mėsos gabalus (300–400 g) tenka virti apie 2 val. Endotoksinas greitai suyra aukštesnėje nei 70 °C temperatūroje. Bakterijos gali daugintis kambario ir žemesnėje temperatūroje net esant mažai deguonies (fakultatyviniai anaerobai). Salmoneliozių etiologinė struktūra nuolat kinta. Periodiškai įsivyrauja vienas serologinis tipas, pvz., S. typhi murium, S. suipestifer, S. enteritidis, S. heidelberg, o šalia jo sutinkama ir kitų – S. budapest, S. london, S. anatum, S. jaja ir kitų.
Epidemiologija. Salmoneliozė yra paplitusi visame pasaulyje. Tikrasis sergamumo lygis yra žymiai didesnis, nei užregistruojama faktiškai. Ekonomiškai išsivysčiusiose šalyse tik iki 1 proc. visų atvejų yra užregistruojama. Apie 60–80 proc. visų salmoneliozės atvejų pasireiškia sporadiškai, tačiau kartais kyla didelių protrūkių.
Infekcijos šaltiniai yra naminiai ir laukiniai gyvuliai, paukščiai, žuvys, graužikai. Gyvuliai ir paukščiai dažnai yra lėtiniai bakterijų nešiotojai. Svarbiausias infekcijos rezervuaras žmogui yra naminiai gyvuliai ir paukščiai. Pastaraisiais metais labai padažnėjo paukštienos ir kiaušinių apkrėstumas salmonelėmis, ypač iš paukštynų. Žmogus, kaip infekcijos šaltinis, yra antraeilės svarbos, todėl kontaktinis plitimo kelias salmoneliozei nebūdingas. Būdamas salmonelių nešiotojas, jis gali užkrėsti maisto produktus. Tačiau sukelti ligą sugeba tik juose pasidauginę mikrobai. Maži vaikai imlesni ir neretai užsikrečia buitinio kontakto būdu nuo salmonelių nešiotojų ar ligonių. Dėl to ši liga gali pasireikšti kaip vaikų hospitalinė infekcija. Užkrečiamo laikotarpio trukmė žmogui svyruoja nuo kelių dienų iki kelių savaičių. Priklausomai nuo serotipo apie 1 proc. suaugusiųjų ir apie 5 proc. vaikų iki 5 metų amžiaus gali išskirti sukėlėjo ilgiau kaip 1 metus. Bakterijų nešiotojai pavojingi dirbdami maisto įmonėse, parduotuvėse, mažų vaikų įstaigose, ligoninėse.
Užkratas dažniausiai perduodamas per netinkamai kulinariškai paruoštą gyvulių bei paukščių mėsą, nesveikų karvių pieną, infekuotus kiaušinius. Mėsa ypač užkrėsta būna tada, kai paskerdžiamas sergantis gyvulys (kuriam yra bakteriemija). Kitais atvejais apdorojant skerdieną salmoneles iš žarnyno galima pernešti į mėsą per įrankius, indus, pjaustymo lentas, stalus, o nuo žalios mėsos – užkrėsti pusfabrikačius bei gatavus produktus (antrinis užteršimas). Sergantys ar užkratą nešiojantys paukščiai gali apteršti kiaušinius išoriškai ar net intraovariškai jiems formuojantis kiaušidėse. Ligos protrūkiai dažnai kyla dėl netinkamo mėsos produktų kulinarinio paruošimo ir jų laikymo. Pavojingi yra trumpai kepti mėsos ir žuvies patiekalai, faršai, paštetai, blyneliai su mėsa, žali kiaušiniai, jų kremai, ypač laikant juos šiltai. Aprašyti vandens kilmės salmoneliozės protrūkiai. Dažniau susergama vasaros mėnesiais, kai dažniau vartojama termiškai neapdorotų produktų, rečiau naudojamasi šaldytuvais (iškylos gamtoje, turizmas, šiltesnė aplinkos temperatūra), tačiau ligos protrūkiai galimi bet kada, jei į atskirą vietovę įvežama užkrėsto produkto. Grupėmis susergama staiga ir tokia banga greitai nuslūgsta, suvartojus ar pašalinus užkrėstą produktą, o sporadinių atvejų pasitaiko ištisus metus. Sergamumas salmonelioze yra didesnis kūdikių ir mažų vaikų.
Užkratas gali būti perduotas taip pat ir buitiniu-kontaktiniu būdu. Daugelio serotipų salmonelių infekcinė dozė yra didelė. Ji svyruoja nuo 106 iki 109, tačiau kai kurių serotipų salmonelių infekcinė dozė yra maža, 102–3 bakterijų. Todėl galimas ir užkrato perdavimas per aplinkos daiktus ir nešvarias rankas. Sergamumas salmoneliozėmis Lietuvoje XX a. antroje pusėje gerokai padidėjo ir šiuo metu prilygsta ar net pralenkia šigeliozę. Beje, išvengti salmoneliozių nepavyksta ir ekonomiškai išsivysčiusioms šalims. Tai aiškinama tuo, kad vis labiau plėtojamos visuomeninio maitinimo paslaugos, bet atsilieka maisto gamybos sanitarinė priežiūra, be to, vyksta gyvulių ir jų produktų, kombinuotų pašarų tarptautiniai mainai, gyvūnų bei paukščių migracija.
Patogenezė ir patologija. Atskirų salmonelių serologinių tipų patogeniškumas yra panašus. Jis priklauso nuo endotoksino, pasigaminančio organizme. Patekusios į skrandį salmonelės sukelia katarinį gastritą, greitai patenka į kraują, tačiau bakteriemija dažniausiai trumpalaikė. Tik tifoidinių bei sepsinių formų atvejais ji gali užtrukti ilgiau. Dalis bakterijų pasiekia žarnyną, sukelia enteritą, rečiau – kolitą. Bakteriemiją lydi intoksikacija, karščiavimas, vazomotoriniai sutrikimai, kuriuos gilina vandens ir druskų nuostolis. Tai lemia suaktyvėjusi enterocitų adenilciklazė, slopinanti jų readsorbciją iš žarnyno. Sunkiais atvejais vystosi infekcinis-toksinis ir hipovoleminis šokas, sutrinka inkstų funkcija, kyla pavojus ligonio gyvybei.
Atliekant autopsiją nustatoma stipri skrandžio ir žarnų gleivinės hiperemija, kraujosruvų, žarnų limfinio aparato ir pasaito limfmazgių hiperplazija.Tokiuoseorganuose kaip inkstai, kepenys, rečiau antinksčiai ar širdis būna distrofinių-degeneraciniųpokyčių. Mirus nuo sepsinių ligos formų, galima rasti pūlinių židinių įvairiuose organuose, plaučių uždegimo ar meningito požymių. Iš žarnų turinio, tulžies, limfmazgių bei pūlinių židinių galima išskirti salmonelių.
Persirgus salmonelioze susidaro imunitetas, tačiau jis tipospecifinisirnevisadapakankamas. Dėl to galima susirgti pakartotinai ar tapti ilgalaikiu užkrato nešiotoju.
Klinika. Inkubacijos periodas trunka dažniausiai 12–72 valandas. Tipiškai liga prasideda ūmiai pykinimu, vėmimu, skausmu duobutėje, viduriavimu vandeningomis išmatomis, karščiavimu iki 38–39 °C, šaltkrėčiu, kaulų ir raumenų skausmu, vargina šleikštulys ir troškulys. Apžiūrint matyti baltas sausas liežuvis, sumažėjęs odos turgoras. Pilvas jautrus duobutėje, žarnos gurguliuoja, neretai būna skausminga dešinė klubinė pilvo sritis. Per 5–7 dienas kūno temperatūra dažniausiai tampa normali, susitvarko viduriai. Tačiau salmoneliozės klinika yra gana įvairi. Dažniausias klinikines formas ir jų variantus pateikiame 2.2.1 lentelėje (pagal P. Čibirą, 1989).
Dažniausios ir būdingiausios yra gastrointestininės formos (apie 80 proc.), tarp jų gastroenteritinis variantas (apie 60 proc.). Sunkiais jo atvejais (apie 5 proc.) liga primena cholerą. Gausiai vemiant ir viduriuojant netenkama daug vandens bei elektrolitų. Pablogėja odos elastingumas ir turgoras, paaštrėja ligonio veido bruožai, įdumba akys, prikimsta balsas, pasireiškia raumenų spazmas (mėšlungis), sumažėja kraujospūdis, atsiranda oligurija ar net anurija, vystosi azotemija. Intoksikacija, hipovolemija, kraujo sutirštėjimas trikdo hemodinamiką, todėl atsiranda lūpų cianozė, atšąla galūnės, oda pablykšta, tampa „marmuruota“, kūno temperatūra mažesnė nei normali (algidinė būklė). Gana dažnas yra gastritinis ligos variantas. Jis esti trumpalaikis (abortinis), dažnai praeina be medicinos pagalbos arba diagnozuojamas kaip gastritas. Jo kilmė paaiškėja tik susirgus grupei asmenų arba patvirtinus bakteriologiškai (3–5 proc. ligonių). Enterokolitinis ir gastroenterokolitinis variantai pasireiškia pilvo diegliais dešinėje klubinėje srityje, skausmingu viduriavimu su gleivių, rečiau kraujo priemaiša. Todėl kliniškai jie nesiskiria nuo šigeliozės. Asmenys, sergantys enteritiniu ligos variantu (apie 10 proc. ligonių), nevemia, tik viduriuoja vandeningomis išmatomis. Tifoidinės ligos formos primena vidurių šiltinę ar paratifą, pasireiškia karščiavimu, trunkančiu 1–2 savaites, neryškiais dispepsijos požymiais, kartais polimorfiniubėrimu.Kraujyjedažniau aptinkama leukopenija ir bakteriemija. Sepsinės formos yra retos. Jos pasižymi užtrukusiu remituojančiu karščiavimu su šaltkrėčiu, prakaitavimu, kartais pageltimu ar petechiniu bėrimu. Gali tęstis bakteriemija, prasidėti pneumonija, otitas, osteomielitas ar meningitas. Taip dažniau serga maži vaikai ir nusilpę asmenys. Mišri (nozoparazitinė) ligos forma suprantama kaip salmoneliozės derinys su kita infekcine liga. Bakterijų dažniausiai nebūna ilgai nešiojamų ir tuo metu klinika nepasireiškia. Ligos formų ir variantų pavadinimai atspindi jų ypatumus ir nurodo diferencijuotinas ligas.
Diagnostika. Salmoneliozę reikia įtarti išsivysčius ūminiam gastroenteritui su karščiavimu ir bendra intoksikacija. Svarbu išsiaiškinti įtartiną maisto produktą, galimą inkubacijos trukmę, susirgimo grupiškumą. Tačiau dėl dažno sporadinio sergamumo ir kliniško ligos įvairumo diagnozę reikia patvirtinti laboratoriniais tyrimais. Atliekami bakteriologiniai išmatų, skrandžio išplovų (ar vėmalų), kraujo (ligoniui karščiuojant), šlapimo, medžiagos iš uždegimo židinių (pūlių, likvoro ir kt.), įtartinų maisto produktų tyrimai. Kartu ieškoma ir kitų žarnyno bakterijų – šigelių, jersinijų, stafilokokų, rotavirusų, sąlygiškai patogeniškos floros,oepidemiologiškaiįtarus–ircholerosvibrionų. Patvirtinti salmoneliozės diagnozę retrospektyviai gali padėti ir serologiniai tyrimai (NHAR, ELISA).
Salmoneliozės skirtinos nuo maisto intoksikacijų, idiosinkrazijų, apsinuodijimų alkoholiu, grybais, vaistais, diabetinės ketoacidozės, azotemijos, o vaikams – nuo acetoneminės toksikozės. Šie ligoniai paprastai nekarščiuoja, ligos kilmę paaiškina susirgimo aplinkybės. Salmoneliozę neretai primena ūminės chirurginės pilvo ligos (apendicitas, ileitas, perforuota skrandžio opa ir kt.). Joms būdingas stiprus, progresuojantis pilvo skausmas, raumenų įtempimas ir kiti pilvaplėvės dirginimo simptomai, didėjanti leukocitozė, karščiavimas. Tokiais atvejais svarbu laiku konsultuotis su chirurgu, neskirti antibiotikų, vidurių laisvinamųjų vaistų ar loperamido („Imodium“), kurie gali užmaskuoti ligą.
Gydymas. Tikslai: 1) pašalinti užkrėsto maisto likučius iš virškinimo trakto; 2) stabilizuoti kraujotaką ir homeostazę; 3) paveikti sukėlėją; 4) šalinti atskirus simptomus, skirti tinkamą dietą.
Jei ligonis vemia, skubiai plaunamas skrandis šiltu 2 proc. sodos ar 0,1 proc. kalio permanganato tirpalu (vaikams – fiziologiniutirpalu).Ka i ligonis neviduriuoja,tikslinga valomoji klizma. Esant toksikozei, elektrolitų disbalansui ir nestipriai (1°) pakanka ligonį girdyti gliukozės ir elektrolitų tirpalais (rehidronu, oralitu, gastrolitu) po 20–30 ml kas 3–5 min. apie 60 ml/kg per 6 val. Kai būklė sunkesnė (2–3° eksikozė), į veną lašinama polijoninių tirpalų (Ringerio, Filipso I), 5–10 proc. gliukozės, atsižvelgus į prarasto skysčio kiekį (suaugusiesiems apie 60 ml/kg), kol atsistatys kraujospūdis, išnyks burnos sausmė ir troškulys. Esant sunkiai būklei, iš pradžių tirpalai leidžiami srovele, kartu skiriama priemonių nuo šoko – vazopresorių, gliukokortikoidų. Daugeliu atvejų tikslinga ir skatinti kuo daugiau gerti, ir lašinti tirpalų į veną. Antibakteriniai preparatai rekomenduojami gydant sunkias ir generalizuotas (tifoidines, sepsines) ligos formas, vaikams iki 1 metų, suaugusiems asmenims, vyresniems nei 50 metų, esant imunodeficitineibūklei, po širdies vožtuvų ar sąnarių protezavimo ir kt. Dažniausiai pakanka trimetoprimo-sulfametoksazolio po 480 mg gerti 2 kartus per parą 5–7 dienas. Sunkesniems ligoniams skiriama amoksicilino po 0,5–1,0 gerti 3–4 kartus per parą arba ciprofloksacinopo 500 mg gerti 2 kartus per parą 5–7 dienas. Esant imunodeficitinei būklei, antibiotikais turi būti gydoma 14 dienų. Viduriavimui silpninti tinka bismuto subnitratas, kalcio karbonatas, pykinimui mažinti – cerukalis, reglanas, motiliumas, antihistamininiai preparatai. Ligoniams maitinti skiriama „Ptm Sk↓“ dieta, į kurią įeina nekoncentruotas sultinys, pertrinta daržovių sriuba, virta malta mėsa, neriebi žuvis, košės, balta duona, sausainiai, nesaldus kompotas, kisielius, kefyras, du bananai.
Ligos prognozė palyginti gera, net ir sunkiai sergant, jei laiku buvo suteikta skubi pagalba. Retai (mažiau nei 1 proc.) pasitaiko mirties atvejų nuo infekcinio-toksinio šoko bei hipovolemijos, inkstų nepakankamumo, o kūdikiams – nuo sepsinių komplikacijų.