Tuberkuliozė

E. Davidavičienė
Tuberkuliozė (Tuberculosis) – tai lėtinė infekcinė liga, kurios sukėlėjai dažniausiai plinta oro lašeliniu būdu, pakenkia plaučius, bet gali būti ir inkstų, žarnų, akių bei kitų vidaus organų patologija.
Etiologija. Tuberkuliozę sukelia Mycobacterium tuberculosis, atrasta R. Kocho 1882 m., gerokai rečiau – Mycobacterium bovis ir Mycobacterium africanum. Ji yra lazdelių formos, 2–5 μm, silpnai dažosi įprastais dažymo būdais. Cylio Nilseno būdu nusidažo raudonai. Kultūroje tuberkuliozės sukėlėjai auga iš lėto (2–6 savaites) specialioje terpėje ir po 2–3 mėn. tampa 3–4 mm dydžio kolonijomis, primenančiomis žiedinį kopūstą. Pastaraisiais metais vis svarbesnės tampa atsparios tuberkuliozės sukėlėjų rūšys.
Epidemiologija. Tuberkuliozės mikobakterijomis užsikrėtę ir šia liga rizikuoja susirgti apie trečdalis žemės gyventojų. Kasmet aktyvia tuberkulioze suserga daugiau nei 8 milijonai žmonių ir miršta apie 2 milijonus. Daugiau nei 90 proc. visų tuberkuliozės atvejų ir mirčių nuo jos registruojama besivystančiose šalyse. Apie 75 proc. ligonių yra 15–54 m., o tai lemia didelius ekonominius nuostolius dėl nedarbingumo. Pradėjus plisti ŽIV epidemijai, labai padaugėjo tuberkuliozės atvejų ne tik Afrikoje, bet ir visame pasaulyje. Pagrindinės tuberkuliozės dažnėjimo priežastys yra nedarbas, alkoholizmas, nepakankama mityba, sumažėjęs dėmesys savo sveikatai, besitęsiantys sveikatos sistemos pertvarkymai bei koinfekcija su ŽIV. Maliarija, kaip ŽIV ir tuberkuliozė, yra svarbiausia infekcinė liga, kurios plitimo stabdymas yra vienas iš pagrindinių PSO uždavinių. Pereito amžiaus dešimtajame dešimtmetyje buvo sukurta šiuolaikinė tuberkuliozės kontrolės sistema, kurios pagrindas – užkrečiamųjų ligos atvejų diagnozavimas ir gydymas. Sistema pavadinta DOTS (angl. Directly Observed Treatment shortcourse). Amsterdame 2000 m. kovo mėn. priimtoje deklaracijoje pritarta pagreitinti DOTS plėtrą ir priimti globaliniai tikslai: išaiškinti 70 proc. užkrečiamų tuberkuliozės atvejų ir 85 proc. jų išgydyti. 1993 m. PSO tuberkuliozę paskelbė globaline prioritetine problema.
Problemiška ir tai, kad daugėja atsparių tuberkuliozės sukėlėjų žinomiems vaistams.
Lietuvoje nuo 1990 iki 1998 m. tuberkuliozės atvejų padvigubėjo. 1998 m. mūsų šalyje buvo patvirtinta Lietuvos valstybinė tuberkuliozės profilaktikosirkontrolės programa ir pradėta įgyvendinti DOTS strategija. Per 6 metus (1998–2004) sergamumą tuberkulioze pavyko sumažinti 15 proc., o mirštamumą nuo jos – 4,8 proc. Deja, tuberkuliozė ir toliau lieka sunkiai valdoma infekcinė liga mūsų šalyje.
Pagrindinis tuberkuliozės šaltinis – atvira plaučių tuberkulioze sergantis žmogus, kurio skrepliuose randama tuberkuliozės mikobakterijų.
Pavojingiausi tie asmenys, kurių skrepliuose tiriant mikroskopu randama rūgščiai atsparių mikobakterijų. Atvira tuberkulioze sergantis asmuo per metus gali užkrėsti nuo 0 iki 35 sveikų asmenų. Dažniausias tuberkuliozės mikobakterijų perdavimo būdas – oro lašelinis (aerogeninis), taip liga perduodama 95 proc. atvejų. Į aplinką tuberkuliozės mikobakterijų patenka kosint, čiaudint, juokiantis, kai su smulkiais lašeliais mikobakterijų patenka į plaučių alveoles, kur ir vystosi tuberkuliozės procesas. Antras pagal dažnį tuberkuliozės mikobakterijų perdavimo būdas yra alimentinis (maistas, pienas). Gamtinis rezervuaras yra stambieji raguočiai – karvės, jaučiai. Galima užsikrėsti vartojant sergančių gyvulių nepasterizuotą pieną ar jo produktus, valgant nevirtą mėsą. Tokiais atvejais infekcija pirmiausia pakenkia žarnyną arba tonziles. Nuo stambiųjų raguočių žmonės gali užsikrėsti M. bovis bacilomis aerogeniniu būdu.
Ne kiekvienas su ligoniu kontaktavęs žmogus infekuojamas tuberkuliozės mikobakterijomis. Infekuotų tuberkuliozės mikobakterijomis, bet nepatiriančių tuberkuliozės ligos simptomų asmenų reakcija į tuberkuliną būna teigiama. Apie 10 proc. infekuotų asmenų per gyvenimą gali susirgti tuberkulioze. Šios ligos vystymasis priklauso nuo tuberkuliozės mikobakterijų kiekio ir makroorganizmo būklės.
Patogenezė ir patologija. Pagal patogenezę skiriama pirminė ir antrinė tuberkuliozė. Pirmine tuberkulioze žmonės suserga, kai šios ligos sukėlėjų į organizmą patenka pirmą kartą. Apie 95 proc. jų patenka pro kvėpavimo takus kartu su iškvepiamu oru ir nusėda plaučiuose. Tuberkuliozės mikobakterijos dauginasi plaučių alveolėse, nedaug jų patenka į kraują, pasklinda po organizmą ir gali pažeisti inkstus, kaulus, smegenis.
Tuberkuliozė dažniausiai vystosi dešiniojo plaučio viršutinėje skiltyje. Subpleurinėse alveolėse prasideda eksudacinis uždegimas, eksudatas greitai nekrozuoja, susidaro standus, apvalios formos, nuo soros iki riešuto dydžio židinys, apie kurį susidaro serozinio uždegimo zona. Jis vadinamas „pirminiu tuberkuliozės židiniu“ arba „pirminiu afektu“ (afectus primarius).
Patekusios į regioninius limfmazgius tuberkuliozės mikobakterijos sukelia specifinį uždegimą – limfinisaudinyshiperplazuoja,ančiuose susidaro tuberkuliozinių mazgelių, greitai įvyksta viso pažeisto limfmazgio kazeozinė nekrozė – kazeozinis limfadenitas. Vienu metu vystosi kelių limfmazgių specifiniaipokyčiai.Pirminisafektas,limfangitas ir kazeozinis limfadenitas sudaro pirminį tuberkuliozės kompleksą.
Užsikrėtus per maistą, pirminis tuberkuliozės kompleksas susidaro žarnyne. Tuberkuliozės mikobakterijos į žarnos sienelę įsiskverbia pro limfinįfolikuląarbaPejerioplokštelę. Infekcijos įėjimo vietoje susidaro tuberkulų, kurie greit nekrozuoja ir žarnoje susidaro opa (pirminis afektas). Toliau tuberkuliozės procesas pereina į limfagysles (limfangitas), susidaro tuberkulų, paveikiami regioniniai limfmazgiai, išsivysto kazeozinis limfadenitas. Taip susidaro pirminis kompleksas žarnyne. Susidarius pirminiam tuberkuliozės kompleksui, ligos eiga priklauso nuo bendros organizmo būklės: ligonis gali pradėti sveikti arba liga progresuoja. Diseminuota tuberkuliozė yra tarpinė tarp pirminės ir antrinės tuberkuliozės.
Antrinei tuberkuliozei priskiriamos įvairios plaučių ir ekstrapulmoninės tuberkuliozės formos. Antrinės plaučių tuberkuliozės formos:
• židininė;
• infiltracinė;
• tuberkuloma;
• kaverninė;
• fibrokaverninė;
• cirozinė.
Ekstrapulmoninės tuberkuliozės formos:
• tuberkulioziniai meningitai;
• tuberkulioziniai pleuritai;
• tuberkulioziniai perikarditai;
• kepenų ir blužnies tuberkuliozė;
• periferinių mezenterinių limfmazgių tuberkuliozė;
• kaulų ir sąnarių tuberkuliozė;
• urogenitalinės sistemos tuberkuliozė.
Tuberkuliozė gali pakenkti bet kokį organą: gerklas, bronchus, odą ir poodinius audinius, antinksčius ir kt.
Klinika. Dažnai tuberkulioze sergantys ligoniai niekuo nesiskundžia. Vis dėlto pagal pagrindinius nusiskundimus galima skirti kelis sindromus.
• Intoksikacinis – silpnumas, nedarbingumas, sutrikęs miegas, svorio kritimas, subfebrili temperatūra, prakaitavimas, ypač naktimis.
• Respiracinis – kosulys, skrepliuojama ilgiau nei 3 savaites, atkosima kraujo, dusulys, kartais krūtinės skausmai.
• Kiti simptomai priklauso nuo pažeidimo vietos. Jei pažeisti galvos smegenų dangalai – galvos skausmas ir sprando raumenų rigidiškumas, jeigu gerklos – užkimęs balsas ir gerklės skausmas, jeigu tuberkuliozės procesas palietė kaulų ir sąnarių sistemą – sąnarių pokyčiai ir skausmai ir kt.
Labai svarbi epidemiologinė anamnezė. Būtina išsiaiškinti, ar ligonis nekontaktavo su tuberkulioze (ypač atvira jos forma) sergančiu asmeniu. Svarbu žinoti, ar anksčiau jis nesirgo šia liga, ar tuberkulioze nesirgo artimieji, ar niekas iš artimųjų nemirė nuo šios ligos. Nustatyta, kad tuberkulioze sergančio asmens šeimos nariai šia liga suserga penkis kartus dažniau. Svarbūs didesnės rizikos veiksniai – bloga nuotaika, nepatenkinamos socialinės ir darbo sąlygos, teigiami Mantu mėginiai, ŽIV infekcija ir AIDS, vartojami kortikosteroidai, imunosupresinis gydymas, rūkymas, silikozė, diabetas, persirgtas pleuritas, užsitęsusi pneumonija ir kitos organizmo imuninę sistemą silpninančios būsenos.
Objektyviai apžiūrint matyti, kad ligoniai liesi, pečiai pakilę, krūtinė statinės formos, galima veido cianozė. Tai būna toli pažengusios tuberkuliozės atveju. Palpuojant galima apčiuopti padidėjusius periferinius limfmazgius (kaklo, pažastų ir kitų grupių), perkutuojant girdėti paduslėjęs plaučių garsas, nustatoma pleuros ertmėje esant skysčio, timpanitas, esant kavernoms. Auskultuojant išklausomi drėgni karkalai, esant kazeozinei pneumonijai, amforinis kvėpavimas ties didele kaverna, šiurkštus kvėpavimas infiltracijosvietoje.Kartaistuberkuliozės objektyvūs duomenys gali būti labai skurdūs, o liga toli pažengusi.
Tuberkuliozinis meningitas. Tai viena iš pavojingiausių gyvybei tuberkuliozės formų. Jis gali išsivystyti kaip antrinė liga, sergant kitų organų tuberkulioze, arba gali būti kaip atskira liga. Tuberkuliozės mikobakterijų į smegenų dangalus gali patekti iš bet kurio tuberkuliozės židinio, kuris gali būti bet kurios stadijos: infiltracijos,petrifikacijos,inkapsuliacijos ir kt. Dažniausiai sukėlėjų patenka hematogeniniu, rečiau limfogeniniu ar likvorogeniniu keliu. Skiriamos kelios tuberkuliozinio meningito formos.
Išsivysčius seroziniam (reaktyviniam, alerginiam) meningitui, serozinio eksudato susikaupia smegenų bazėje, o likvoro pokyčiai nedideli. Jo baigtis gera.
Kita forma – bazinis tuberkuliozinis meningitas – pasitaiko dažniausiai. Jam išsivysčius, meninginiai simptomai ryškūs, tuberkulioziniai mazgeliai lokalizuojasi smegenų bazėje, o ligos eiga sunkoka.
Tuberkuliozinis meningoencefalitas išsivysto užsitęsus baziniam meningitui ar vėlai diagnozavus meningitą, kai uždegimas pereina iš dangalų į smegenų substanciją. Jam būdingi židininiai reiškiniai, dideli likvoro pokyčiai, ligos eiga sunki, prognozė bloga, nes gali likti paralyžius ir parezės.
Tuberkulioziniam cerebrospinaliniam meningitui būdinga, kad uždegimo procesas lokalizuojasi galvos, nugaros smegenų dangaluose. Pokyčiai stiprūs, išsivysto parezės, paralyžiai, neretai sutrinka dubens organų funkcija.
Klinika. Liga prasideda iš lėto, ligoniai būna vangūs, vargina galvos skausmai, vėmimas, nesusijęs su suvalgytu maistu. Vėliau ligoniai tampa mieguisti, pritemsta sąmonė. Pasireiškia smegenų dangalų dirginimo simptomai, padidėja odos jautrumas, ryškus dermografizmas.Ankstyvuligosperiodupažeidžiami galvos smegenų nervai, ypač n. facialis ir n. opticus. Akių dugne yra edema, procesui progresuojant, optinis nervas atrofuojasi ir ligonis gali apakti. Kūdikių ir ankstyvo amžiaus vaikų tuberkuliozinio meningito požymiai būna mažiau išreikšti.
Pagrindinis tuberkuliozinio meningito diagnostikos metodas – likvoro tyrimas. Nustatomas padidėjęs likvoro spaudimas, likvoras skaidrus, kartais opalescencinis, padaugėję ląstelinių elementų – iš pradžių limfocitinė neutrofilinė, vėliau – limfocitinė citozė. Baltymų reakcijos (Pandy) teigiamos. Likvore sumažėjęs gliukozės ir chloridų kiekis, likvorui pastovėjus susidariusioje plėvelėje randama mikobakterijų.
Ligos diferencinė diagnozė sunki. Skirtina nuo sezoninio virusinės kilmės meningito, encefalito, smegenų auglio, smegenų absceso, tuberkulomos.
Diagnostika. Periferinio kraujo pokyčiai priklauso nuo proceso išplitimo ir komplikacijų. Ūminei tuberkuliozei būdinga saikinga leukocitozė, formulės nuokrypis į kairę pusę – padidėjęs neutrofilų toksinis grūdėtumas, limfocitopenija, su didele eozinofilija, nedaug padidėjęs ENG. Ūmi monocitozė gali reikšti naują tuberkuliozės proceso išsisėjimą. Imunologiniai tyrimai svarbūs tuberkuliozės diferencinei diagnostikai.
Esant aktyviai tuberkuliozei, būna teigiamos limfocitų blasttransformacijos ir migracijos stabdymo reakcijos su specifiniutuberkuliozės antigenu tuberkulinu.
Tuberkulioziniam pleuritui būdingas serozinis, skaidrus, gintarinės spalvos skystis, jo lyginamasis svoris didesnis negu 1,015, baltymo 3–6 g/100 ml, pozityvi Rivalto reakcija. Skystyje būna 1 000–5 000 celių mm3, vyrauja limfocitai (neutrofilaigalivyrautipirmą ligos savaitę), gliukozės koncentracija būna mažesnė negu kraujyje.
Ligos sukėlėjas nustatomas bakteriologiniais metodais. Tai skreplių, pleuros punktatų, šlapimo ir kitų išskyrų pasėlis. Bakterioskopiniai metodai – tiesioginė dažyto Cylio Nilseno būdu tepinėlio ar gautų nuosėdų koncentracijos būdu tepinėlio mikroskopija. PSO rekomenduoja atlikti tris skreplių mikroskopinius tyrimus. Jautresnis negu mikroskopija yra kultūrų auginimo metodas, kai tiriamoji medžiaga sėjama į specialias mitybines terpes. Šiuo metu naudojami aparatiniai tyrimai tuberkuliozės mikobakterijoms greičiau nustatyti. Tai radiometrinis BACTEC 460 TB, fluorescencinisMGII 960 ir molekuliniai genetiniai tyrimai: PGR (polimerazės grandininė reakcija, LGR – ligazės grandininė reakcija, „Bact Alert“ ir „ProbTec“ tuberkuliozės mikobakterijoms ir jų jautrumui vaistams nustatyti, „Gen Probe“ – tuberkuliozės mikobakterijoms ir ne tuberkuliozės bakterijoms identifikuoti.Beto,tuberkuliozės diagnostikai svarbi radiologinė diagnostika, nors ji neatsako į pagrindinį klausimą – kokia yra plaučių ar kitų organų pokyčių priežastis. Šis metodas labai svarbus diferencinei diagnostikai. Praktiniame darbe dažniausiai naudojami radiologiniai tyrimo metodai yra rentgenoskopija, rentgenografija,tomografijairkompiuterinė tomografija.Dažnai tuberkuliozės diagnostikai naudojama bronchoskopija ir videotorakoskopija.
Kocho atrastas tuberkulino mėginys daugiausia naudojamas vaikų infekuotumui ir tuberkuliozei nustatyti. Tuberkulinas yra baltyminis tuberkuliozės mikobakterijų produktas, turintis sukėlėjo genetinę informaciją. Jis sudarytas iš proteinų, peptidų, nukleorūgščių, lipidų ir angliavandenių. Lietuvoje tuberkuliozės, ypač vaikų, diagnostikai naudojamas Mantu mėginys. Vaikų reakcija teigiama, jei papulė 5–16 mm dydžio, suaugusiųjų – 5–20 mm, vaikų reakcija hipererginė, jei infiltratasdidesnisnegu21mm.
Šiuo metu tuberkuliozei diagnozuoti pasiūlytas naujas metodas – Kvantiferono (Quantiferon) mėginys. Jo esmė – antikūnų nuo tuberkuliozės sukėlėjo nustatymas, kai jie išsiskiria iš užsikrėtusio tuberkulioze žmogaus limfocitų. Šis tyrimas padeda nustatyti užsikrėtimo šia liga faktą, bet neleidžia atskirti, ar užsikrėsta naujai, ar liga latentinė. Mėginys neatspindi ligos 100 proc., kol kas jo efektyvumas aiškinamas.
Diferencinė diagnostika. Įvairios plaučių tuberkuliozės formos skirtinos nuo plaučių diseminuotos sarkoidozės, plaučių karcinozės, įvairių formų fibrozuojančioalveolito– plaučių vėžio, nespecifinėspneumonijos,plaučiųabsceso,gerybiniųplaučiųauglių,vėžinių metastazių, grybelinių plaučių ligų.
Gydymas. Gydant tuberkulioze sergantį asmenį, svarbu kuo greičiau pasiekti, kad skrepliuose nebeliktų sukėlėjų, visiškai išgydyti ligonį, kol plaučių pokyčiai nedideli, išvengti mirčių nuo tuberkuliozės ir užkirsti kelią atsparios tuberkuliozės vystymuisi. Skiriami vaistai ir gydymo trukmė reguliuojami pagal ligonių gydymo kategorijas. Gydoma turi būti nuolat, skiriamos pakankamos dozės, medicinos personalas privalo stebėti visą gydymo kursą. Jis trunka 6–8 mėn., kai sukėlėjas jautrus skiriamiems vaistams, ir iki 9 mėn., kai jis atsparus. Diagnozavus dauginį atsparumą vaistams, gydoma iki 24 mėn.
Skiriama ir pirmos, ir antros eilės vaistų nuo tuberkuliozės. Pirmos eilės vaistai – izoniazidas, pirazinamidas, mifampicinas, streptomicinas ir etambutolis.
Antros eilės – tiamidai (etionamidas / protionamidas, paraaminosalicilo Na rūgštis, amikacinas, kapriomicinas) ir chinolonai (ofloksacinas,iprofiloksacinas,levofloksacinas, moksifloksacinas,levofloksacinasbeigatifloksacinas).Rezerviniaivariantai– makrolidai, klofaziminas, rifabutinas, ampicilinas ar amoksicilinas su klavulano rūgštimi, ß laktamazei stabilūs cefalosporinai (pastarieji dar tiriami).
Tuberkuliozinis meningitas gydomas specifiniaisvaistaispagalgydymokategoriją.Jis gali užtrukti iki 12 mėn. ir ilgiau. Be specifiniųvaistųskiriamadiuretikų,hormonų(dažniausiai prednizolono). Kartu skiriama simptominių vaistų, reabilitacijos priemonės.
Tuberkuliozės diagnostikos, gydymo ir kontrolės organizavimo veikloje dalyvauja gydytojas pulmonologas, šeimos gydytojas, vidaus ligų gydytojas, bendruomenės slaugytojos ir bendrosios praktikos slaugytojos. Gydymo taktikos pagal PSO aprobuotas schemas parinkimas – gydytojo pulmonologo kompetencija.
Priešepideminės priemonės ir profilaktika. Efektyviausia tuberkuliozės profilaktika– anksti išaiškinti, kurie asmenys serga, ir juos gydyti, kad ligoniai kuo greičiau nustotų skleisti į aplinką tuberkuliozės mikobakterijas ir nekeltų pavojaus aplinkiniams. Sanitarinė tuberkuliozės profilaktika–sanitariniųirepidemiologiniųpriemoniųvisuma tuberkuliozės židiniui sanuoti. Tuberkuliozės židiniu vadinamas sergantis šia liga ir su juo bendraujantys artimiausi žmonės. Tuo tikslu skiriama patalpų, ligonio aplinkos daiktų, spjaudyklių ir kitų buitinių daiktų dezinfekcija, mokomas ligonis ir jo šeimos nariai.